Clinisciences > ADAMTS4 antibody - N-terminal region
ADAMTS4 antibody - N-terminal region
Référence ARP41556_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
ADAMTS4 Antibody - N-terminal region (ARP41556_P050)
| Datasheets/Manuals | Printable datasheet for anti-ADAMTS4 (ARP41556_P050) antibody |
|---|
| Publications | Boerboom, D. et al. Partially redundant functions of Adamts1 and Adamts4 in the perinatal development of the renal medulla. Dev. Dyn. 240, 1806-14 (2011). 215849051$s> Lee, C. W. et al. Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina. J. Clin. Pathol. 64, 399-404 (2011). 213458771$s> Lee, S.-Y. et al. Differential expression patterns of a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) -1, -4, -5, and -14 in human placenta and gestational trophoblastic diseases. Arch. Pathol. Lab. Med. 138, 643-50 (2014). 247861211$s> |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ADAMTS4 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ADAMTS4 (ARP41556_P050) antibody is Catalog # AAP41556 (Previous Catalog # AAPP24241) |
| Gene Symbol | ADAMTS4 |
|---|---|
| Gene Full Name | ADAM metallopeptidase with thrombospondin type 1 motif, 4 |
| Alias Symbols | ADMP-1, ADAMTS-2, ADAMTS-4 |
| NCBI Gene Id | 9507 |
| Description of Target | ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma. |
| Uniprot ID | Q8NEK2 |
| Protein Accession # | AAH30812 |
| Protein Size (# AA) | 339 |
| Molecular Weight | 37kDa |
| Protein Interactions | YTHDC1; ZBTB16; ELAVL1; UBC; MT2A; SRPX2; ADAMTS4; BCAN; SERPINA1; ACAN; HP; FURIN; FN1; SERPINA3; |
Protein interactions
| Name | # of Products |
|---|---|
| ACAN | 53 |
| ADAMTS4 | 56 |
| BCAN | 38 |
| FN1 | 361 |
| FURIN | 68 |
| HP | 61 |
| MT2A | 8 |
| SERPINA1 | 105 |
| SERPINA3 | 104 |
| SRPX2 | 10 |
Biological process
| Name | # of Products |
|---|---|
| Proteolysis | 456 |
| Skeletal system development | 140 |
Cellular components
| Name | # of Products |
|---|---|
| Extracellular region | 1573 |
| Extracellular space | 884 |
| Proteinaceous extracellular matrix | 159 |
Protein function
| Name | # of Products |
|---|---|
| Metal ion binding | 5514 |
| Metalloendopeptidase activity | 183 |
| Metallopeptidase activity | 190 |
| Peptidase activity | 1080 |
| Protease binding | 376 |
| Protein binding | 12191 |
| Zinc ion binding | 3721 |
-
Adamts4 Antibody - N-terminal region (ARP41555_P050)Catalog #: ARP41555_P050Species Tested: RatApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
ADAMTS4 ELISA Kit (Human) (OKBB00627)Catalog #: OKBB00627Application: ELISAKit Range: 625 pg/ml - 40,000 pg/mlSensitivity: <20 pg/ml -
ADAMTS4 ELISA Kit (Human) : 96 Wells (OKEH02632)Catalog #: OKEH02632Application: ELISA-SandwichKit Range: 0.312-20ng/mLSensitivity: 0.092 ng/mL -
ADAMTS4 ELISA Kit (Rat) (OKEH03412)Catalog #: OKEH03412Application: ELISA-SandwichKit Range: 78-5000pg/mLSensitivity: 40.4 pg/mL -
ADAMTS4 Recombinant Protein (OPCD01107)Catalog #: OPCD01107Conjugation: UnconjugatedApplication: Ctrl (+), SDS-PAGE, WBFormat: Freeze-dried Powder. PBS, pH7.4, containing 0.01% SKL, 5% Trehalose.


