Adrenocorticotropic hormone (TFA)

Référence HY-106373A-50mg

Conditionnement : 50mg

Marque : MedChemExpress


Description

Adrenocorticotropic hormone (ACTH; Adrenocorticotrophic hormone) TFA is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone TFA stimulates cortisol secretion from the adrenal cortex via the hypothalamic-pituitary-adrenal (HPA) axis. Adrenocorticotropic hormone TFA regulates cortisol and androgen production. Adrenocorticotropic hormone TFA can promote the development of spermatogenesis. Adrenocorticotropic hormone TFA can relieve acute inflammation in gout models by inhibiting the polarization of macrophages to M1 type, inhibiting ROS and proinflammatory factor production and protecting mitochondrial function. Adrenocorticotropic hormone TFA can be used for the researches of inflammation, endocrinology, metabolic disease, such as gout and nephrotic syndrome[1][2][3][4].

IC50 & Target[3]

IL-6

 

IL-1β

 

In Vitro

Adrenocorticotropic hormone (100 nM, 5weeks) TFA induces clusters development of spermatogenesis isolated from mouse seminiferous tubules and significantly increases the proportion of pre-meiotic cells (CDH-1, VASA, MC2R-positive) and the expression of PLZF, VASA, MC2R, THY-1 genes[2].
Adrenocorticotropic hormone (100 nM, 5weeks) TFA significantly increases the proportion and gene expression of meiotic marker BOULE-positive cells in cells isolated from mouse seminiferous tubules and has no significant effect on the proportion of meiotic marker CREM-positive cells, increases the proportion of post-meiotic marker ACROSIN-positive cells but decreases its gene expression, and has no effect on the expression of SCP3 and PROTAMINE[2].
Adrenocorticotropic hormone (1.25×10-4-2.5×10-4 U/ml, 48 h) TFA inhibits phagocytic function in MSU-stimulated THP-1-induced macrophages, promotes the polarization of MSU-stimulated macrophages to M2 type, downregulates the secretion of M1-type proinflammatory factors IL-1β, IL-6, and TNF-α, inhibit ROS production and reduces the opening of mitochondrial permeability transition pores (mPTP) to protect mitochondrial function[3].
Adrenocorticotropic hormone (1.25×10-4 U/ml, 48 h) TFA regulates the transcription of inflammation-related genes by upregulating genes such as NR1H2, IL-37, and FccRIIIA, and downregulating genes such as NLRP3, MC2R, and MC3R in THP-1-induced macrophages[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Adrenocorticotropic hormone (0.25-2.5 U/mL, s.c., 30 minutes after MSU intra-articular injection) TFA significantly alleviates joint swelling, reduces inflammatory cell infiltration in joint tissues, and has no significant effect on serum cortisol levels in gout mice models[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: MSU-induced gout mice models (C57BL/6, 6 weeks)[3]
Dosage: 0.25 U/mL or 2.5 U/mL
Administration: Subcutaneously injection, 30 minutes after MSU intra-articular injection
Result: Reduced inflammatory cell infiltration in joint tissues.
Had no significant effect on serum cortisol levels.
Essai clinique
Masse moléculaire

4541.14 (free base)

Formule

C207H308N56O58S.xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe

Sequence Shortening

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvant et solubilité
In Vitro: 

H2O : 50 mg/mL (Need ultrasonic)

  • Calculateur de molarité

  • Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureté et documentation
Références