ANKRD42 Antibody - N-terminal region - Biotin
Référence ARP41193_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
ANKRD42 Antibody - N-terminal region : Biotin (ARP41193_P050-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ANKRD42 (ARP41193_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD42 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANKRD42 (ARP41193_P050-Biotin) antibody is Catalog # AAP41193 (Previous Catalog # AAPP22568) |
| Gene Symbol | ANKRD42 |
|---|---|
| Gene Full Name | Ankyrin repeat domain 42 |
| Alias Symbols | SARP, PPP1R79 |
| NCBI Gene Id | 338699 |
| Protein Name | Ankyrin repeat domain-containing protein 42 |
| Description of Target | The function remains unknown. |
| Uniprot ID | Q8N9B4 |
| Protein Accession # | NP_872409 |
| Nucleotide Accession # | NM_182603 |
| Protein Size (# AA) | 389 |
| Molecular Weight | 43kDa |
| Protein Interactions | PPP1CC; UBC; |