Anti-HMPV M2/Protein M2-2 Polyclonal Antibody

Référence NB-21-38860

Conditionnement : 100µg

Marque : Neo Biotech


Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Specifications Anti-HMPV M2/Protein M2-2 Polyclonal Antibody

Product name ARO-A13491-100
Uniprot ID Q6WB96
Raw Antigen Sequence TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Protein M2-2, M2, Human metapneumovirus (strain CAN97-83) (HMPV)
Reference ARO-A13491
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant HMPV M2/Protein M2-2 (Thr2-Ser71).
Product name ARO-A13491-1MG
Uniprot ID Q6WB96
Raw Antigen Sequence TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Protein M2-2, M2, Human metapneumovirus (strain CAN97-83) (HMPV)
Reference ARO-A13491
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant HMPV M2/Protein M2-2 (Thr2-Ser71).
Product name ARO-A13491-50
Uniprot ID Q6WB96
Raw Antigen Sequence TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Protein M2-2, M2, Human metapneumovirus (strain CAN97-83) (HMPV)
Reference ARO-A13491
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant HMPV M2/Protein M2-2 (Thr2-Ser71).

Documents

QC & Validation

Anti-HMPV M2/Protein M2-2 Polyclonal Antibody binds to Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His in WB Assay

Anti-HMPV M2/Protein M2-2 Polyclonal Antibody binds to Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His in WB Assay

Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His(cat. No.ARO-P15733) can bind Anti-HMPV M2/Protein M2-2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

3D Representation

Anti-HMPV M2/Protein M2-2 Polyclonal Antibody

Reviews

There are no reviews yet.

Be the first to review “Anti-HMPV M2/Protein M2-2 Polyclonal Antibody” Cancel reply

Related products

  • Anti-HMPV N/Nucleoprotein Polyclonal Antibody in WB Assay

    ARO-A13489

    Anti-HMPV N/Nucleoprotein Polyclonal Antibody