Bovine tracheal antimicrobial peptide
Référence HY-P5632
Conditionnement : Onrequest
Marque : MedChemExpress
| Description |
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively[1]. |
|---|---|
| Masse moléculaire |
4084.98 |
| Formule |
C169H296N58O45S7 |
| Sequence |
Asn-Pro-Val-Ser-Cys-Val-Arg-Asn-Lys-Gly-Ile-Cys-Val-Pro-Ile-Arg-Cys-Pro-Gly-Ser-Met-Lys-Gln-Ile-Gly-Thr-Cys-Val-Gly-Arg-Ala-Val-Lys-Cys-Cys-Arg-Lys-Lys (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
| Sequence Shortening |
NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
| Livraison | Room temperature in continental US; may vary elsewhere. |
| Stockage |
Please store the product under the recommended conditions in the Certificate of Analysis. |
| Pureté et documentation | |
| Références |

