C1orf151 Antibody - middle region

Référence ARP44801_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology


C1orf151 Antibody - middle region (ARP44801_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-MINOS1 (ARP44801_P050) antibody
Product Info
Publications

Disturbed mitochondrial maturation in cardiolipin remodeling-deficient cardiomyocytes

Authors: Senoo, N., Sheridan, M. S., et al.

Journal: iScience. 29, 115111 (2026)

Reduced Protein Import via TIM23 SORT Drives Disease Pathology in TIMM50-Associated Mitochondrial Disease

Authors: Crameri, J. J., Palmer, C. S., et al.

Journal: Mol Cell Biol. 44, 226-244 (2024)

A novel homozygous variant in MICOS13/QIL1 causes hepato-encephalopathy with mitochondrial DNA depletion syndrome

Authors: Kishita, Y., Shimura, M., et al.

Journal: Mol Genet Genomic Med. 8, e1427 (2020)

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C1orf151
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277)
Enhanced Validation
Relative Expression (Western Blot)
Avivasheild

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
0100-20
 20mL 
0100-01
 25mL