C9orf116 (NM_144654) Human Tagged ORF Clone

Référence RG205731

Conditionnement : 10ug


C9orf116 (NM_144654) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG205731
C9orf116 (tGFP-tagged) - Human chromosome 9 open reading frame 116 (C9orf116), transcript variant 2
 
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C9orf116
Synonyms PIERCE1; RbEST47
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205731 representing NM_144654
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGGAATGCCCCAGAGCGTGCGCGGAGCCTGTGGCGCCCAAGGCCACGGCCCCGCCGGAGAGGA
CCAGCGACTACTACCGCGTGAGCGCGGACCTGCCGGGCAGGTTCAACAACCCGGGGTGGTTCCGGGGCTA
CAGGACCCAGAAGGCTGTCTCCGTGTACAGGACCAGTAACCAGGCTTACGGGAGCAGAGCCCCCACCGTG
CACGAGATGCCTCGGGTGGAATGTTCCGGAACAATACTCTCAATGTTTACCTGGAGAAAAGCATCG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205731 representing NM_144654
Red=Cloning site Green=Tags(s)

MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTV
HEMPRVECSGTILSMFTWRKAS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_144654
ORF Size 276 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_144654.3
RefSeq Size 685 bp
RefSeq ORF 279 bp
Locus ID 138162
UniProt ID Q5BN46
Cytogenetics 9q34.3
SKU Description Size
RC205731 C9orf116 (Myc-DDK-tagged)-Human chromosome 9 open reading frame 116 (C9orf116), transcript variant 2 10 ug
RC205731L3 Lenti ORF clone of Human chromosome 9 open reading frame 116 (C9orf116), transcript variant 2, Myc-DDK-tagged 10 ug
RC205731L4 Lenti ORF clone of Human chromosome 9 open reading frame 116 (C9orf116), transcript variant 2, mGFP tagged 10 ug
SC108064 C9orf116 (untagged)-Human chromosome 9 open reading frame 116 (C9orf116), transcript variant 2 10 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
HY-17394-500mg
 500mg