CD81 Antibody - C-terminal region - Biotin

Référence ARP63231_P050-Biotin

Conditionnement : 100ul

Marque : Aviva Systems Biology


CD81 Antibody - C-terminal region : Biotin (ARP63231_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-CD81 (ARP63231_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Cow, Dog, Goat, Horse, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human CD81
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 83%; Dog: 93%; Goat: 83%; Horse: 75%; Human: 100%; Pig: 86%; Sheep: 92%
Peptide SequenceSynthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD81 (ARP63231_P050-Biotin) antibody is Catalog # AAP63231
Gene SymbolCD81
Gene Full NameCD81 molecule
Alias SymbolsS5.7, CVID6, TAPA1, TSPAN28
NCBI Gene Id975
Protein NameCD81 antigen
Description of TargetThe protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP60033
Protein Accession #NP_001284578.1
Nucleotide Accession #NM_001297649.1
Protein Size (# AA)274
Molecular Weight30kDa