- Specifications
Product Description
Human DNMT1 partial ORF ( NP_001370, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — DNMT1
Entrez GeneID
1786GeneBank Accession#
NM_001379Protein Accession#
NP_001370Gene Name
DNMT1
Gene Alias
AIM, CXXC9, DNMT, FLJ16293, MCMT, MGC104992
Gene Description
DNA (cytosine-5-)-methyltransferase 1
Omim ID
126375Gene Ontology
HyperlinkGene Summary
DNA (cytosine-5-)-methyltransferase 1 has a role in the establishment and regulation of tissue-specific patterns of methylated cytosine residues. Aberrant methylation patterns are associated with certain human tumors and developmental abnormalities. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CXXC finger protein 9|DNA methyltransferase 1
- Interactomes
- Pathways
- Diseases
DNMT1 (Human) Recombinant Protein (Q01)
Référence H00001786-Q01
Conditionnement : 10ug
Marque : Abnova
DNMT1 (Human) Recombinant Protein (Q01)
Images


