E2f7 Antibody - middle region - HRP

Référence ARP47764_P050-HRP

Conditionnement : 100ul

Marque : Aviva Systems Biology


E2f7 Antibody - middle region : HRP (ARP47764_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-E2f7 (ARP47764_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Rat E2f7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: NSLQLDVVGDSAVDDYEKRRPSRKQKSLGLLCQKFLARYPSYPLSTEKTT
Concentration0.5 mg/ml
Blocking PeptideFor anti-E2f7 (ARP47764_P050-HRP) antibody is Catalog # AAP47764
Gene SymbolE2f7
Alias SymbolsE2F-7
NCBI Gene Id314818
Description of TargetThe function of this protein remains unknown.
Protein Accession #NP_001101562
Nucleotide Accession #NM_001108092
Protein Size (# AA)514
Molecular Weight56kDa