Clinisciences > EN1 Antibody - C-terminal region - Biotin
EN1 Antibody - C-terminal region - Biotin
Référence P100923_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-EN1 (P100923_P050-Biotin) antibody |
|---|
| Publications | Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene (2013). doi:10.1038/onc.2013.422 WB, ELISA, Guinea pig, Pig, Rabbit 24141779 |
|---|---|
| Predicted Species Reactivity | Guinea Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EN1 |
| Predicted Homology Based on Immunogen Sequence | Guinea Pig: 93%; Rabbit: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-EN1 (P100923_P050-Biotin) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025) |
| Reference | Atit,R., (2006) Dev. Biol. 296 (1), 164-176 |
|---|---|
| Gene Symbol | EN1 |
| Gene Full Name | Engrailed homeobox 1 |
| Alias Symbols | ENDOVESLB |
| NCBI Gene Id | 2019 |
| Protein Name | Homeobox protein engrailed-1 |
| Description of Target | Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q05925 |
| Protein Accession # | NP_001417 |
| Nucleotide Accession # | NM_001426 |
| Protein Size (# AA) | 392 |
| Molecular Weight | 40kDa |
| Protein Interactions | TLE1; PAX6; JUN; |
Protein interactions
| Name | # of Products |
|---|---|
| JUN | 324 |
| PAX6 | 83 |
| TLE1 | 178 |
Biological pathways
| Name | # of Products |
|---|---|
| Skeletal system development | 141 |
Biological process
| Name | # of Products |
|---|---|
| Anatomical structure morphogenesis | 88 |
| Dorsal/ventral pattern formation | 34 |
| Embryonic forelimb morphogenesis | 28 |
| Hindbrain development | 27 |
| Midbrain development | 26 |
| Midbrain-hindbrain boundary development | 7 |
| Multicellular organismal development | 896 |
| Neuron development | 43 |
| Pigmentation | 29 |
| Positive regulation of transcription from RNA polymerase II promoter | 968 |
| Proximal/distal pattern formation | 26 |
| Skeletal system development | 140 |
Cellular components
| Name | # of Products |
|---|---|
| Nucleus | 4914 |
Protein function
| Name | # of Products |
|---|---|
| Sequence-specific DNA binding | 1803 |
| Sequence-specific DNA binding transcription factor activity | 2776 |
-
EN1 Antibody - C-terminal region (P100923_P050)Catalog #: P100923_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
EN1 Antibody - middle region (ARP38029_P050)Catalog #: ARP38029_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


