Hantaan virus (strain 76-118) Envelopment polyprotein (His)
Référence NB-64-49468-100ug
Conditionnement : 100ug
Marque : Neo Biotech
Remove All
Hantaan virus (strain 76-118) Envelopment polyprotein (His)
(Synonyms: M polyprotein, GP, Glycoprotein precursor, Envelopment polyprotein) Copy Product InfoSynonyms: M polyprotein, GP, Glycoprotein precursor, Envelopment polyprotein
Catalog No. TMPH-00790 Copy Product Info
Hantaan virus (strain 76-118) Envelopment polyprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 52.7 kDa and the accession number is P08668.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Hantaan virus (strain 76-118) Envelopment polyprotein (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 52.7 kDa and the accession number is P08668. |
| Species | HTNV |
| Expression System | HEK293 Cells |
| Tag | C-6xHis |
| Accession Number | P08668 |
| Amino Acid | SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISGIFSGN |
| Construction | 649-1105 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | M polyprotein, GP, Glycoprotein precursor, Envelopment polyprotein |
| Research Background | Forms homotetramers with glycoprotein C at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion. May dysregulate normal immune and endothelial cell responses through an ITAM motif.; Forms homotetramers with glycoprotein N at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion. |
| Molecular Weight | 52.7 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
M-polyprotein
Related Tags: Hantaan virus (strain 76-118) Envelopment polyprotein (His) chemical structure | Hantaan virus (strain 76-118) Envelopment polyprotein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

