Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag
Référence 584877-20ug
Conditionnement : 20ug
Marque : US Biological
584877 Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag
Swiss Prot
A9NHV3Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CTransfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.
Source:
Recombinant protein corresponding to aa1-118 from Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.
Molecular Weight:
~20.9kD
Amino Acid Sequence:
MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

