Human FAP protein

Référence NB-21-25367

Conditionnement : 100ug

Marque : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q12884
Molecular weight:
27.55 kDa
Ile523–Asp760 His

Specifications Human FAP protein (Ile523-Asp760)

Product name Human FAP protein
Uniprot ID Q12884
Uniprot link https://www.uniprot.org/uniprot/Q12884
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Molecular weight 27.55 kDa
Protein delivered with Tag? His Tag
Purity estimated >90%
Buffer PBS,pH7.5
Form Frozen Liquid or Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile523-Asp760
Spec:Entrez GeneID 2191
Spec:NCBI Gene Aliases FAPA; SIMP; DPPIV; FAPalpha
Spec:SwissProtID Q12884
Aliases /Synonyms Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase
Reference PX-P4887
Note For research use only
Molecular Constructor
Ile523–Asp760 His
Product name Human FAP protein
Uniprot ID Q12884
Uniprot link https://www.uniprot.org/uniprot/Q12884
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Molecular weight 27.55 kDa
Protein delivered with Tag? His Tag
Purity estimated >90%
Buffer PBS,pH7.5
Form Frozen Liquid or Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile523-Asp760
Spec:Entrez GeneID 2191
Spec:NCBI Gene Aliases FAPA; SIMP; DPPIV; FAPalpha
Spec:SwissProtID Q12884
Aliases /Synonyms Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase
Reference PX-P4887
Note For research use only
Molecular Constructor
Ile523–Asp760 His

Description

General information on Human FAP protein

Documents

3D Representation

Human FAP protein (Ile523-Asp760)

Reviews

There are no reviews yet.

Be the first to review “Human FAP protein (Ile523-Asp760)” Cancel reply

Related products

  • Simlukafusp alfa Biosimilar - Anti-FAP;FAPalpha and IL2V mAb - Research Grade binds to Human FAP Recombinant Protein, C-His in WB Assay

    PX-TA1884

    Simlukafusp Biosimilar – Anti-FAP mAb – Research Grade