PX-TA1884
Conditionnement : 100ug
| Product name | Human FAP protein |
|---|---|
| Uniprot ID | Q12884 |
| Uniprot link | https://www.uniprot.org/uniprot/Q12884 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD |
| Molecular weight | 27.55 kDa |
| Protein delivered with Tag? | His Tag |
| Purity estimated | >90% |
| Buffer | PBS,pH7.5 |
| Form | Frozen Liquid or Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ile523-Asp760 |
| Spec:Entrez GeneID | 2191 |
| Spec:NCBI Gene Aliases | FAPA; SIMP; DPPIV; FAPalpha |
| Spec:SwissProtID | Q12884 |
| Aliases /Synonyms | Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase |
| Reference | PX-P4887 |
| Note | For research use only |
| Molecular Constructor | Ile523–Asp760 His |
| Product name | Human FAP protein |
|---|---|
| Uniprot ID | Q12884 |
| Uniprot link | https://www.uniprot.org/uniprot/Q12884 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD |
| Molecular weight | 27.55 kDa |
| Protein delivered with Tag? | His Tag |
| Purity estimated | >90% |
| Buffer | PBS,pH7.5 |
| Form | Frozen Liquid or Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ile523-Asp760 |
| Spec:Entrez GeneID | 2191 |
| Spec:NCBI Gene Aliases | FAPA; SIMP; DPPIV; FAPalpha |
| Spec:SwissProtID | Q12884 |
| Aliases /Synonyms | Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase |
| Reference | PX-P4887 |
| Note | For research use only |
| Molecular Constructor | Ile523–Asp760 His |
There are no reviews yet.