Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)

Référence 518038-100ug

Conditionnement : 100ug

Marque : US Biological



518038 Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)

Swiss Prot
P06996
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Forms pores that allow passive diffusion of small molecules across the outer membrane.

Source:
Recombinant protein corresponding to aa22-367 of E. coli Outer Membrane Protein C, fused to 6xHis-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~42.3kD

Amino Acid Sequence:
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)