Host species: Escherichia coli (E.coli) Origin species: Human Uniprot ID: Q06609 Molecular weight: 20.42 kDa Val174–Asp339 Datasheet Specifications Recombinant Human RAD51, N-His Product name ARO-P13487-100 Uniprot ID Q06609 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD Molecular weight 20.42 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Val174-Asp339 Aliases /Synonyms HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1 Reference ARO-P13487 Note For research use only. Molecular Constructor Val174–Asp339 Product name ARO-P13487-1MG Uniprot ID Q06609 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD Molecular weight 20.42 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Val174-Asp339 Aliases /Synonyms HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1 Reference ARO-P13487 Note For research use only. Molecular Constructor Val174–Asp339 Product name ARO-P13487-50 Uniprot ID Q06609 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD Molecular weight 20.42 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Val174-Asp339 Aliases /Synonyms HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1 Reference ARO-P13487 Note For research use only. Molecular Constructor Val174–Asp339 Documents Datasheet 3D Representation Reviews There are no reviews yet. Be the first to review “Recombinant Human RAD51, N-His” Cancel reply
There are no reviews yet.