Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1)
Référence orb3010245-100ug
Conditionnement : 100ug
Marque : Biorbyt
Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1)
SKU: orb3010245
Description
Research Area
Cell Biology
Images & Validation
−
Key Properties
−| Expression System | Baculovirus |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-68 |
| Protein Length | 68 |
| Endotoxins | Not test |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI |
Storage & Handling
−| Storage | Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Small integral membrane protein 10-like protein 1 SMIM10L1
−
Recombinant Human Small integral membrane protein 10-like protein 1 (SIML1) [orb3009019]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Small integral membrane protein 10-like protein 1 (SIML1), Biotinylated [orb3007787]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Small integral membrane protein 10-like protein 1 (SIML1) [orb3006555]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Small integral membrane protein 10-like protein 1 (SIML1) [orb3004090]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mgRecombinant Human Small integral membrane protein 10-like protein 1 (SIML1), Biotinylated [orb3005322]
Greater than 85% as determined by SDS-PAGE.
20 μg, 100 μg, 1 mg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide