Recombinant Human TP63, N-His

Référence NB-21-30273

Conditionnement : 100µg

Marque : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H3D4
Molecular weight:
35.56 kDa
Ser41–Cys339

Specifications Recombinant Human TP63, N-His

Product name ARO-P13110-100
Uniprot ID Q9H3D4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC
Molecular weight 35.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser41-Cys339
Aliases /Synonyms Keratinocyte transcription factor KET, P63, KET, Tumor protein p73-like, p63, P73L, CUSP, P73H, p40, Tumor protein 63, TP73L, Transformation-related protein 63, TP63, Chronic ulcerative stomatitis protein, p73L, p51
Reference ARO-P13110
Note For research use only.
Molecular Constructor
Ser41–Cys339
Product name ARO-P13110-1MG
Uniprot ID Q9H3D4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC
Molecular weight 35.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser41-Cys339
Aliases /Synonyms Keratinocyte transcription factor KET, P63, KET, Tumor protein p73-like, p63, P73L, CUSP, P73H, p40, Tumor protein 63, TP73L, Transformation-related protein 63, TP63, Chronic ulcerative stomatitis protein, p73L, p51
Reference ARO-P13110
Note For research use only.
Molecular Constructor
Ser41–Cys339
Product name ARO-P13110-50
Uniprot ID Q9H3D4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC
Molecular weight 35.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser41-Cys339
Aliases /Synonyms Keratinocyte transcription factor KET, P63, KET, Tumor protein p73-like, p63, P73L, CUSP, P73H, p40, Tumor protein 63, TP73L, Transformation-related protein 63, TP63, Chronic ulcerative stomatitis protein, p73L, p51
Reference ARO-P13110
Note For research use only.
Molecular Constructor
Ser41–Cys339

Documents

3D Representation

Recombinant Human TP63, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human TP63, N-His” Cancel reply

Related products

  • SDS-PAGE for Anti-Human TP63/p40 Antibody (SAA0486)

    ARO-A14918

    Anti-Human TP63/p40 Antibody (SAA0486)