Recombinant sheep Interferon gamma
Référence OPCA01253-20UG
Conditionnement : 20ug
Marque : Aviva Systems Biology
IFNG Recombinant Protein (Sheep) (OPCA01253)
| Datasheets/Manuals | Printable datasheet for IFNG Recombinant Protein (Sheep) (OPCA01253) |
|---|
| Predicted Species Reactivity | Ovis aries|Sheep |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM |
| Source | Yeast |
| Gene Symbol | IFNG |
|---|---|
| Gene Full Name | interferon gamma |
| Alias Symbols | gamma-interferon, IFN-gamma, interferon gamma. |
| NCBI Gene Id | 443396 |
| Protein Name | Interferon gamma |
| Description of Target | Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. |
| Uniprot ID | P17773 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 18.9 kDa |

