SQLE Antibody - C-terminal region - HRP
Référence ARP42101_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
SQLE Antibody - C-terminal region : HRP (ARP42101_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SQLE (ARP42101_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Additional Information | IHC Information: 721_B cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%. |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SQLE |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SQLE (ARP42101_P050-HRP) antibody is Catalog # AAP42101 (Previous Catalog # AAPP24580) |
| Sample Type Confirmation | SQLE is strongly supported by BioGPS gene expression data to be expressed in 721_B |
| Gene Symbol | SQLE |
|---|---|
| Gene Full Name | Squalene epoxidase |
| Alias Symbols | FLJ30795 |
| NCBI Gene Id | 6713 |
| Protein Name | Squalene monooxygenase |
| Description of Target | Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway. |
| Uniprot ID | Q14534 |
| Protein Accession # | BAA11209 |
| Nucleotide Accession # | NM_003129 |
| Protein Size (# AA) | 574 |
| Molecular Weight | 64kDa |
| Protein Interactions | MARCH6; UBC; ALDOC; ZNF641; CREB3; |
