SRD5A2 antibody - N-terminal region
Référence ARP44264_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
SRD5A2 Antibody - N-terminal region (ARP44264_P050)
| Datasheets/Manuals | Printable datasheet for anti-SRD5A2 (ARP44264_P050) antibody |
|---|
| Tested Species Reactivity | Human, Monkey |
|---|---|
| Predicted Species Reactivity | Human, Pig, Rabbit, Monkey |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Pig: 86%; Rabbit: 91% |
| Peptide Sequence | Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SRD5A2 (ARP44264_P050) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644) |
| Gene Symbol | SRD5A2 |
|---|---|
| Gene Full Name | Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) |
| Alias Symbols | MGC138457 |
| NCBI Gene Id | 6716 |
| Protein Name | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
| Description of Target | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result |
| Uniprot ID | Q28892 |
| Protein Accession # | NP_000339 |
| Nucleotide Accession # | NM_000348 |
| Protein Size (# AA) | 254 |
| Molecular Weight | 28kDa |
