Conditionnement : 100ul
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21. Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 58 kDa |
| Gene Name | T-box 21 |
| Database Link | |
| Background | Transcription factor that controls the expression of the TH1 cytokine, interferon-gamma. Initiates TH1 lineage development from naive TH precursor cells both by activating TH1 genetic programs and by repressing the opposing TH2 programs. |
| Synonyms | T-bet; T-PET; TBET; TBLYM |
| Note | Immunogen Sequence Homology: Pig: 93%; Rat: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Sheep: 86%; Bovine: 86% |
| Reference Data | |
| Protein Categories | Allergies and autoimmune diseases, Cytokines, Intracellular Proteins, Transciption Factors |
| Protein Families | Druggable Genome, Transcription Factors |
| Product Manuals |
| FAQs |
|
| SDS |
| Antibody Resources |
|