Clinisciences > VDAC1 Antibody - C-terminal region
VDAC1 Antibody - C-terminal region
Référence ARP35122_T100-25UL
Conditionnement : 25ul
Marque : Aviva Systems Biology
Aviva Systems Biology will be closed on Friday, July 3rd, in observance of Independence Day.
VDAC1 Antibody - C-terminal region (ARP35122_T100)
| Datasheets/Manuals | Printable datasheet for anti-VDAC1 (ARP35122_T100) antibody |
|---|
| Publications | ArduÃno, D. M. et al. Mitochondrial metabolism in Parkinsonâ, 4680-702 (2012). 22843496 Chen, S. et al. Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins. J. Proteome Res. 8, 5196-211 (2009). 19775189 Rousset, F., Nguyen, M. V. C., Grange, L., Morel, F. & Lardy, B. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8, e66478 (2013). 23840483 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-VDAC1 (ARP35122_T100) antibody is Catalog # AAP35122 (Previous Catalog # AAPP06353) |
| Sample Type Confirmation | VDAC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Zheng,Y., et al., (2004) Oncogene 23 (6), 1239-1247 |
|---|---|
| Gene Symbol | VDAC1 |
| Gene Full Name | Voltage-dependent anion channel 1 |
| Alias Symbols | PORIN, VDAC-1 |
| NCBI Gene Id | 7416 |
| Protein Name | Voltage-dependent anion-selective channel protein 1 |
| Description of Target | The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis. |
| Uniprot ID | Q5FVE7 |
| Protein Accession # | NP_003365 |
| Nucleotide Accession # | NM_003374 |
| Protein Size (# AA) | 283 |
| Molecular Weight | 31kDa |
| Protein Interactions | UBC; KLHL40; SPRTN; MDM2; ADRB2; ASB14; ASB17; PARK2; BAG3; env; VCAM1; HK1; ATF2; FMNL1; TUBA1B; MDC1; CAV1; Htt; SFXN3; SUGP1; UBAP2; UFM1; ACAD9; MGAT4B; ACAA2; ZMPSTE24; VAPA; ALDH5A1; SF1; VDAC3; VDAC2; UBA52; TIAL1; FLOT2; CDK2; SIRT7; SUMO4; MAPK3; |
Protein interactions
| Name | # of Products |
|---|---|
| AI837181 | 241 | BAK1 | 70 |
| BAX | 99 |
| BCL2L1 | 222 |
| BCL2L11 | 43 |
| CD4 | 497 |
| CKMT1A | 4 |
| CSNK2B | 317 |
| CYCS | 49 |
| DCD | 10 |
| DYN | 4 |
| DYNLT1 | 26 |
| DYNLT3 | 34 |
| GABARAPL2 | 107 |
| GSN | 59 |
| Haus3 | 16 |
| HDAC5 | 906 |
| HK1 | 34 |
| HSPA9 | 56 |
| ICT1 | 287 |
| KIF5B | 56 |
| MCC | 72 |
| MCL1 | 93 |
| PANK2 | 8 |
| PorB | 4 |
| PPIF | 5 |
| PRKCE | 118 |
| RAF1 | 213 |
| SNCA | 228 |
| SUMO4 | 252 |
| TOMM20 | 54 |
| TRAF6 | 443 |
| TUBA4A | 102 |
| UBC | 7030 |
Biological pathways
| Name | # of Products |
|---|---|
| Apoptotic process | 1078 |
| Interspecies interaction between organisms | 817 |
Biological process
| Name | # of Products |
|---|---|
| Anion transport | 13 |
| Apoptotic process | 586 |
| Behavioral fear response | 21 |
| Interspecies interaction between organisms | 281 |
| Learning | 36 |
| Neuron-neuron synaptic transmission | 4 |
| Regulation of anion transport | 10 |
| Regulation of ion transmembrane transport | 21 |
| Transmembrane transport | 500 |
Cellular components
| Name | # of Products |
|---|---|
| Membrane | 2769 |
| Mitochondrial inner membrane | 251 |
| Mitochondrial nucleoid | 28 |
| Mitochondrial outer membrane | 89 |
| Mitochondrion | 1154 |
| Plasma membrane | 2678 |
| Pore complex | 9 |
Protein function
| Name | # of Products |
|---|---|
| Porin activity | 18 |
| Protein binding | 12191 |
| Voltage-gated anion channel activity | 19 |
-
VDAC1 Antibody - N-terminal region (OAAB03656)Catalog #: OAAB03656Application: FC,IHC-P,WBFormat: Liquid PBS with 0.09% (W/V) sodium azide. -
VDAC1 Antibody - middle region (OAAB03657)Catalog #: OAAB03657Application: FC,IHC-P,WBFormat: Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by dialysis against PBS. -
VDAC1 Polyclonal Antibody (OABB00732)Catalog #: OABB00732Clone: PolyclonalSpecies Tested: Human, Mouse, RatApplication: FC, ICC, IHC-P, IPFormat: Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4. -
VDAC1 Antibody (OASE00304)Catalog #: OASE00304Conjugation: UnconjugatedClone: S152B-23Application: ICC,IF,IHC,WB -
VDAC1 Antibody (OABF00715)Catalog #: OABF00715Conjugation: UnconjugatedApplication: ELISA|ICC|IF|IHC-Fr|IHC-P|WBFormat: Liquid. Aqueous buffered solution containing 100ug/ml BSA, 50% glycerol and 0.09% sodium azide.


