Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His)
Référence NB-64-52396-200ug
Conditionnement : 200ug
Marque : Neo Biotech
Remove All
Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His)
(Synonyms: VP40, Membrane-associated protein VP40, Matrix protein VP40, Ebola VP40 (eVP40)) Copy Product InfoSynonyms: VP40, Membrane-associated protein VP40, Matrix protein VP40, Ebola VP40 (eVP40)
Catalog No. TMPH-03727 Copy Product Info
Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 39.3 kDa and the accession number is Q77DJ6.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 39.3 kDa and the accession number is Q77DJ6. |
| Species | ZEBOV |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q77DJ6 |
| Amino Acid | MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK |
| Construction | 1-326 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | VP40, Membrane-associated protein VP40, Matrix protein VP40, Ebola VP40 (eVP40) |
| Research Background | Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis). |
| Molecular Weight | 39.3 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
VP 40Matrix protein VP-40Ebola VP-40 (eVP-40)
Related Tags: Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) chemical structure | Zaire ebolavirus (strain Kikwit-95) VP40 Protein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

