Adipose Triglyceride Lipase (PNPLA2) (NM_020376) Human Recombinant Protein

Référence TP305708

Conditionnement : 20ug


Adipose Triglyceride Lipase (PNPLA2) (NM_020376) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305708
Recombinant protein of human patatin-like phospholipase domain containing 2 (PNPLA2), 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205708 protein sequence
Red=Cloning site Green=Tags(s)

MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGVCLGEAGAKFI
EVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTRVSDGENVIISHFNSKDELIQ
ANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIHELRVTNT
SIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVE
SAQAEDYSQLPGEDHILEHLPARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTI
RLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP
GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQLAGPAPLLST
PAPEARPVIGALGL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065109
Locus ID 57104
UniProt ID Q96AD5
Cytogenetics 11p15.5
RefSeq Size 2443
RefSeq ORF 1512
Synonyms 1110001C14Rik; ATGL; FP17548; iPLA2zeta; PEDF-R; TTS-2.2; TTS2
Summary This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy. provided by RefSeq, Jul 2010
Protein Categories Intracellular Proteins
Protein Families Transmembrane
SKU Description Size
PH305708 PNPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_065109) 10 ug
LC402777 Lyophilized PNPLA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY402777 Transient overexpression lysate of patatin-like phospholipase domain containing 2 (PNPLA2) (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Vous serez peut-être également intéressé par les produits suivants :