ALX3 Antibody - N-terminal region - Biotin
Référence ARP37852_T100-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
ALX3 Antibody - N-terminal region : Biotin (ARP37852_T100-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-ALX3 (ARP37852_T100-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse ALX3 |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Guinea Pig: 77%; Human: 79%; Mouse: 100%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ALX3 (ARP37852_T100-Biotin) antibody is Catalog # AAP37852 (Previous Catalog # AAPP09975) |
| Reference | Yamada,R., et al., (2004) Dev. Biol. 274 (2), 295-307 |
|---|---|
| Gene Symbol | ALX3 |
| Gene Full Name | Aristaless-like homeobox 3 |
| NCBI Gene Id | 11694 |
| Protein Name | Homeobox protein aristaless-like 3 |
| Description of Target | Mouse Alx3 is a homeobox gene that is related to the Drosophila aristaless gene and to a group of vertebrate genes including Prx1, Prx2, Cart1, and Alx4. The protein encoded contains a diverged variant of a conserved peptide sequence present near the carboxyl terminus of at least 15 different paired-class-homeodomain proteins. Alx3 is expressed in mouse embryos from 8 days of gestation onward in a characteristic pattern, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm. |
| Uniprot ID | O70137 |
| Protein Accession # | NP_031467 |
| Nucleotide Accession # | NM_007441 |
| Protein Size (# AA) | 343 |
| Molecular Weight | 38kDa |
| Protein Interactions | Jdp2; |
