Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 protein
Référence orb705012-1mg
Conditionnement : 1mg
Marque : Biorbyt
Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 protein
SKU: orb705012
Description
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Anemonia sulcata (Mediterranean snakelocks sea anemone) |
| Tag | N-terminal GST-tagged |
| Expression Region | 1-62aa |
| Protein Length | Full Length of Mature Protein |
| MW | 33.5 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−asFP595
−
Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 protein [orb705020]
Greater than 85% as determined by SDS-PAGE.
35.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μgGFP-like non-fluorescent chromoprotein FP595 Antibody [orb864014]
ELISA, WB
Rabbit
Polyclonal
Unconjugated
2 mg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide




