Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Anti-DDX4 Polyclonal antibody

Anti-DDX4 Polyclonal antibody

Imprimer Imprimer
Identifiez-vous

Référence NB-21-36375

Conditionnement : 100µg

Marque : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG
Anti-DDX4 Polyclonal antibody binds to Recombinant Human DDX4, N-His in WB Assay
Anti-DDX4 Polyclonal antibody

Specifications Anti-DDX4 Polyclonal antibody

Product name ARO-A13627-100
Uniprot ID Q9NQI0
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4,
Reference ARO-A13627
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DDX4 (Asn35-Gly131).
Product name ARO-A13627-1MG
Uniprot ID Q9NQI0
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4,
Reference ARO-A13627
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DDX4 (Asn35-Gly131).
Product name ARO-A13627-50
Uniprot ID Q9NQI0
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4,
Reference ARO-A13627
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DDX4 (Asn35-Gly131).

Documents

QC & Validation

Anti-DDX4 Polyclonal antibody binds to Recombinant Human DDX4, N-His in WB Assay

Anti-DDX4 Polyclonal antibody binds to Recombinant Human DDX4, N-His in WB Assay

Recombinant Human DDX4, N-His(cat. No.ARO-P13069) can bind Anti-DDX4 Polyclonal antibody in Western Blot Assay as detected on gel analysis.

3D Representation

Anti-DDX4 Polyclonal antibody

Reviews

There are no reviews yet.

Be the first to review “Anti-DDX4 Polyclonal antibody” Cancel reply

Related products

  • Recombinant Human DDX4, N-His

    ARO-P13069

    Recombinant Human DDX4, N-His