Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> ANXA4 antibody - N-terminal region

ANXA4 antibody - N-terminal region

Imprimer Imprimer
Identifiez-vous

Référence ARP36686_T100

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

  • Target Name: ANXA4
    Sample Tissue: Human Fetal Liver
    Antibody Dilution: 1.0ug/mlHuman Fetal Liver
  • Target: ANXA4
    Positive control (+): Human stomach (ST)
    Negative control (-): 293T (2T)
    Antibody concentration: 1ug/mlHuman stomach, 293T
Datasheets/ManualsPrintable datasheet for anti-ANXA4 (ARP36686_T100) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-ANXA4 (ARP36686_T100) antibody is Catalog # AAP36686 (Previous Catalog # AAPP08113)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceZimmermann,U., et al., (2004) Cancer Lett. 209 (1), 111-118
Publications

de la Cuesta, F. et al. A proteomic focus on the alterations occurring at the human atherosclerotic coronary intima. Mol. Cell. Proteomics 10, M110.003517 (2011). 21248247

Staquicini, F. I. et al. Vascular ligand-receptor mapping by direct combinatorial selection in cancer patients. Proc. Natl. Acad. Sci. U. S. A. 108, 18637-42 (2011). 22049339

Gene SymbolANXA4
Gene Full NameAnnexin A4
Alias SymbolsANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274
NCBI Gene Id307
Protein NameAnnexin RuleBase RU003540
Description of TargetAnnexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.
Uniprot IDQ6LES2
Protein Accession #NP_001144
Nucleotide Accession #NM_001153
Protein Size (# AA)321
Molecular Weight36 kDa
Protein InteractionsPADI4; UBC; EZH2; DNAJB11; MPST; ANXA7; ANXA3; ANXA1; TINF2; POT1; SUMO2; NMT2; SMPD1; Cdk1; UCHL5; H2AFX; NFKB1; GP2;
Protein interactions
Name# of Products
Cdk1487
GP212
H2AFX444
NFKB1256
NMT233
SMPD119
UBC7030
UCHL5365
Biological pathways
Name# of Products
Anti-apoptosis727
Signal transduction939
Biological process
Name# of Products
Anti-apoptosis239
Negative regulation of coagulation6
Signal transduction1058
Cellular components
Name# of Products
Cytoplasm4549
Protein function
Name# of Products
Calcium ion binding1062
Calcium-dependent phospholipid binding88
Phospholipase inhibitor activity40

  1. What is the species homology for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ANXA4 Antibody - N-terminal region (ARP36686_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    This target may also be called "ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274" in publications.

  5. What is the shipping cost for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANXA4 Antibody - N-terminal region (ARP36686_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANXA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANXA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANXA4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANXA4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANXA4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANXA4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.