ATP5B antibody - N-terminal region

Référence ARP48185_T100

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-ATP5F1B (ARP48185_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-ATP5F1B (ARP48185_T100) antibody is Catalog # AAP48185 (Previous Catalog # AAPP28694)
Subunitbeta, mitochondrial
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceVantourout,P., (2008) Mol. Immunol. 45 (2), 485-492
Publications

A Chinese herbal formula, Jian-Pi-Yi-Shen decoction, improves muscle atrophy via regulating mitochondrial quality control process in 5/6 nephrectomised rats. Sci Rep. 7, 9253 (2017). 28835671

Antioxidant Apigenin Relieves Age-Related Muscle Atrophy by Inhibiting Oxidative Stress and Hyperactive Mitophagy and Apoptosis in Skeletal Muscle of Mice. J Gerontol A Biol Sci Med Sci. 75, 2081-2088 (2020). 32857105

Bannister, J. P. et al. Ca(V)1.2 channel N-terminal splice variants modulate functional surface expression in resistance size artery smooth muscle cells. J. Biol. Chem. 286, 15058-66 (2011). 21364284

Guo, J. et al. Protein targets for carbonylation by 4-hydroxy-2-nonenal in rat liver mitochondria. J. Proteomics 74, 2370-9 (2011). 21801862

Li, N., Bates, D. J., An, J., Terry, D. A. & Wang, E. Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain. Neurobiol. Aging 32, 944-55 (2011). 19487051

Resveratrol Improves Muscle Atrophy by Modulating Mitochondrial Quality Control in STZ-Induced Diabetic Mice. Mol Nutr Food Res. 62, e1700941 (2018). 29578301

Description
Gene SymbolATP5F1B
Gene Full NameATP synthase F1 subunit beta
Alias SymbolsATP5B, ATPMB, ATPSB, HEL-S-271
NCBI Gene Id506
Protein NameATP synthase subunit beta, mitochondrial
Description of TargetThis gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
Uniprot IDP06576
Protein Accession #NP_001677
Nucleotide Accession #NM_001686
Protein Size (# AA)529
Molecular Weight57 kDa
Protein InteractionsFUS; FDX1; ATP5A1; HUWE1; ATPAF2; TRIM63; TRIM55; SPRTN; STAU1; GRSF1; UBC; MDM2; ASB5; ASB11; SUZ12; RNF2; EZH2; BMI1; GBP1; ADRB2; TERT; vpu; UBL4A; WHSC1; VCAM1; PPP1CC; ITGA4; FN1; ESR1; ATF2; BTK; YWHAE; SUMO2; CA9; FMNL1; ATP5O; ATP6V1B2; ATP5C1; AT
  1. What is the species homology for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP5F1B Antibody - N-terminal region (ARP48185_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?

    This target may also be called "ATP5B, ATPMB, ATPSB, HEL-S-271" in publications.

  5. What is the shipping cost for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP5F1B Antibody - N-terminal region (ARP48185_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP5F1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP5F1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP5F1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP5F1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP5F1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP5F1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT