CD90 Recombinant Protein
Référence orb1495150-1mg
Conditionnement : 1mg
Marque : Biorbyt
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
CD90 Recombinant Protein
Catalog Number: orb1495150
| Catalog Number | orb1495150 |
|---|---|
| Category | Proteins |
| Description | CD90 Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~17kDa |
| UniProt ID | P04216 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |