CLDN1 antibody - C-terminal region

Référence ARP33623_P050

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-CLDN1 (ARP33623_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLDN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CLDN1 (ARP33623_P050) antibody is Catalog # AAP33623 (Previous Catalog # AAPP04679)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceCoyne,C.B., et al., (2003) Am. J. Physiol. Lung Cell Mol. Physiol. 285 (5), L1166-L1178
Description
Gene SymbolCLDN1
Gene Full NameClaudin 1
Alias SymbolsCLD1, SEMP1, ILVASC
NCBI Gene Id9076
Protein NameClaudin-1
Description of TargetTight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
Uniprot IDO95832
Protein Accession #NP_066924
Nucleotide Accession #NM_021101
Protein Size (# AA)211
Molecular Weight23 kDa
Protein InteractionsUBC; DRG1; LNX1; TJP3; BRD4; MPDZ; TJP2; CLDN1; INADL; CLDN3; WNK4; TJP1; MMP14; MMP2; CLDN5;
  1. What is the species homology for "CLDN1 Antibody - C-terminal region (ARP33623_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "CLDN1 Antibody - C-terminal region (ARP33623_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CLDN1 Antibody - C-terminal region (ARP33623_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CLDN1 Antibody - C-terminal region (ARP33623_P050)"?

    This target may also be called "CLD1, SEMP1, ILVASC" in publications.

  5. What is the shipping cost for "CLDN1 Antibody - C-terminal region (ARP33623_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "CLDN1 Antibody - C-terminal region (ARP33623_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CLDN1 Antibody - C-terminal region (ARP33623_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "23 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CLDN1 Antibody - C-terminal region (ARP33623_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CLDN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CLDN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CLDN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CLDN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CLDN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CLDN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.