Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> DLX4 antibody - N-terminal region

DLX4 antibody - N-terminal region

Imprimer Imprimer
Identifiez-vous

Référence ARP36839_T100

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

  • ELISA Titer: 1:312500
    Positive Control: NIH/3T3 cell lysateMouse NIH-3T3
Datasheets/ManualsPrintable datasheet for anti-DLX4 (ARP36839_T100) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse DLX4
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVP
Concentration1.0 mg/ml
Blocking PeptideFor anti-DLX4 (ARP36839_T100) antibody is Catalog # AAP36839 (Previous Catalog # AAPP09912)
ReferenceKelly,R.G., et al., (2004) Hum. Mol. Genet. 13 (22), 2829-2840
Gene SymbolDLX4
Gene Full NameDistal-less homeobox 4
Alias SymbolsDlx, Dlx-, Dlx7, Dlx-4
NCBI Gene Id13394
Protein NameHomeobox protein DLX-4
Description of TargetDLX4 is a member of the family of Dlx genes that are involved in early vertebrate morphogenesis, notably of the head.
Uniprot IDP70436
Protein Accession #NP_031893
Nucleotide Accession #NM_007867
Protein Size (# AA)240
Molecular Weight26kDa
Protein InteractionsSp7; Zfp263;
Protein interactions
Name# of Products
Sp74
Zfp2634
Biological pathways
Name# of Products
Multicellular organismal development570
Biological process
Name# of Products
Multicellular organismal development896
Regulation of transcription, DNA-dependent1734
Cellular components
Name# of Products
Cellular_component556
Nucleus4914
Protein function
Name# of Products
DNA binding3958
Sequence-specific DNA binding1803
Sequence-specific DNA binding transcription factor activity2776
Transcription regulatory region sequence-specific DNA binding124

  1. What is the species homology for "DLX4 Antibody - N-terminal region (ARP36839_T100)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "DLX4 Antibody - N-terminal region (ARP36839_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DLX4 Antibody - N-terminal region (ARP36839_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DLX4 Antibody - N-terminal region (ARP36839_T100)"?

    This target may also be called "Dlx, Dlx-, Dlx7, Dlx-4" in publications.

  5. What is the shipping cost for "DLX4 Antibody - N-terminal region (ARP36839_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "DLX4 Antibody - N-terminal region (ARP36839_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DLX4 Antibody - N-terminal region (ARP36839_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "26kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DLX4 Antibody - N-terminal region (ARP36839_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DLX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DLX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DLX4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DLX4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DLX4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DLX4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.