EDN1 Antibody

Référence OAAF07958

Conditionnement : 100ug

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for EDN1 Antibody (OAAF07958)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationELISA, IF, IHC-P, WB
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from the Internal region of human EDN1.
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide SequenceSynthetic peptide located within the following region: AEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
Concentration1mg/ml
SpecificityEDN1 Antibody detects endogenous levels of EDN1 protein.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
ELISA: 1:10000
Gene SymbolEDN1
Gene Full Nameendothelin 1
Alias SymbolsARCND3;endothelin-1;ET1;HDLCQ7;PPET1;preproendothelin-1;QME.
NCBI Gene Id1906
Protein NameEndothelin-1
Description of TargetEndothelins are endothelium-derived vasoconstrictor peptides.
Uniprot IDP05305
Molecular Weight24 kDa
  1. What is the species homology for "EDN1 Antibody (OAAF07958)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "EDN1 Antibody (OAAF07958)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "EDN1 Antibody (OAAF07958)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EDN1 Antibody (OAAF07958)"?

    This target may also be called "ARCND3;endothelin-1;ET1;HDLCQ7;PPET1;preproendothelin-1;QME." in publications.

  5. What is the shipping cost for "EDN1 Antibody (OAAF07958)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "EDN1 Antibody (OAAF07958)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EDN1 Antibody (OAAF07958)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EDN1 Antibody (OAAF07958)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EDN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EDN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EDN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EDN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EDN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EDN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT