Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (Biotin)

FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (Biotin)

Imprimer Imprimer
Identifiez-vous

Référence 126611-Biotin-100ul

Conditionnement : 100ul

Marque : US Biological


126611-BiotinFAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (Biotin)

Specifications
Clone TypeMonoclonal
Hostmouse
Sourcehuman
IsotypeIgG1,k
GradeAffinity Purified
ApplicationsE IHC WB
CrossreactivityHu
Accession #BC026346; AAH26346
Shipping TempBlue Ice
Storage Temp-20°C

FAM84A (Family with sequence similarity 84 member A) was identified in a screen for genes up-regulated in colon cancer. It may play a role in cell migration and has a critical role in the progression of colon cancer.

Applications:
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQHAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG1,k|Clone No: 1C2|Host: mouse|Source: human|Concentration: As Reported|Form: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Full length recombinant protein corresponding to aa1-292 from human FAM84A (BC026346; AAH26346) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human FAM84A.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Full length recombinant protein corresponding to aa1-292 from human FAM84A (BC026346; AAH26346) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FAM84A.