Fibroblast growth factor 21(FGF21)(29-210)
Référence NB-21-24584
Conditionnement : 100ug
Conditionnement : 100ug
| Product name | Fibroblast Growth Factor proteins 21(FGF21)(29-210) |
|---|---|
| Uniprot ID | Q9JJN1 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9JJN1 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
| Molecular weight | 21.15kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >80%by SDS-PAGE |
| Buffer | PBS, pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ala29-Ser210 |
| Protein Accession | Q9JJN1 |
| Spec:Entrez GeneID | 56636 |
| Spec:NCBI Gene Aliases | Fgf8c |
| NCBI Reference | Q9JJN1 |
| Aliases /Synonyms | FGF-21 |
| Reference | PX-P4735 |
| Note | For research use only |
| Molecular Constructor | His Ala29–Ser210 |