Human BMI1 protein
Référence orb245172-1mg
Conditionnement : 1mg
Marque : Biorbyt
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Human BMI1 protein
Catalog Number: orb245172
| Catalog Number | orb245172 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Polycomb complex protein BMI-1 |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 56.4 kDa |
| Target | BMI1 |
| UniProt ID | P35226 |
| Protein Sequence | MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | 1-250aa |
| Expression Region | 1-250aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | BMI1 PCGF4 RNF51 |
| Note | For research use only |
| Application notes | This is GST-tag protein |
| Expiration Date | 6 months from date of receipt. |