Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> IYD Antibody - N-terminal region

IYD Antibody - N-terminal region

Imprimer Imprimer
Identifiez-vous

Référence ARP66837_P050

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

  • Target Name: IYD
    Sample Type: 293T Whole Cell lysates
    Antibody Dilution: 1.0ug/mlHuman 293T
Datasheets/ManualsPrintable datasheet for anti-IYD (ARP66837_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human IYD
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 79%; Human: 100%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: NADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENV
Concentration0.5 mg/ml
Blocking PeptideFor anti-IYD (ARP66837_P050) antibody is Catalog # AAP66837
Gene SymbolIYD
Alias SymbolsTDH4, IYD-1, DEHAL1, C6orf71
NCBI Gene Id389434
Protein NameIodotyrosine dehalogenase 1
Description of TargetThis gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4.
Uniprot IDQ6PHW0-3
Protein Accession #NP_001158167
Nucleotide Accession #NM_001164695
Protein Size (# AA)247
Molecular Weight27kDa
Protein InteractionsTRIM69;
Biological pathways
Name# of Products
Cellular nitrogen compound metabolic process116
Hormone biosynthetic process84
Biological process
Name# of Products
Cellular nitrogen compound metabolic process173
Oxidation-reduction process160
Small molecule metabolic process825
Thyroid hormone generation17
Cellular components
Name# of Products
Integral to membrane2793
Plasma membrane2678
Protein function
Name# of Products
Oxidoreductase activity982
Diseases
Name# of Products
Congenital hypothyroidism42
Disease mutation5332

  1. What is the species homology for "IYD Antibody - N-terminal region (ARP66837_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Rabbit".

  2. How long will it take to receive "IYD Antibody - N-terminal region (ARP66837_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IYD Antibody - N-terminal region (ARP66837_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IYD Antibody - N-terminal region (ARP66837_P050)"?

    This target may also be called "TDH4, IYD-1, DEHAL1, C6orf71" in publications.

  5. What is the shipping cost for "IYD Antibody - N-terminal region (ARP66837_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "IYD Antibody - N-terminal region (ARP66837_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IYD Antibody - N-terminal region (ARP66837_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IYD Antibody - N-terminal region (ARP66837_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IYD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IYD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IYD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IYD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IYD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IYD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.