mouse Anti-GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa) (FITC) Monoclonal Antibody [Clone:3G7]
Référence 246526-FITC-100ul
Conditionnement : 100ul
Marque : US Biological
246526-FITC GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa) (FITC)
Clone Type
MonoclonalHost
mouseIsotype
IgG2a,kGrade
PurifiedApplications
E IFAccession #
NP_003634Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq
Applications:
Suitable for use in Immunofluorescence. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

