mouse Anti-TRIB3 (Tribbles Homolog 3, TRB3, TRB-3, Neuronal Cell Death-inducible Putative Kinase, NIPK, p65-interacting Inhibitor of NF-kappa-B, C20orf97, SINK, SKIP3) (APC) Monoclonal Antibody [Clone:1H2]
Référence 134719-APC-100ul
Conditionnement : 100ul
Marque : US Biological
134719-APC TRIB3 (Tribbles Homolog 3, TRB3, TRB-3, Neuronal Cell Death-inducible Putative Kinase, NIPK, p65-interacting Inhibitor of NF-kappa-B, C20orf97, SINK, SKIP3) (APC)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
BC027484, AAH27484Shipping Temp
Blue IceStorage Temp
4°C Do Not Freeze
Applications:
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.
AA Sequence:
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.

