PCMT1 Rabbit Polyclonal Antibody (FITC)
Référence orb2114106-100ul
Conditionnement : 100ul
Marque : Biorbyt
Description
Research Area
Signal Transduction
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Related Conjugates & Formulations
−Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PCMT1 |
| Protein Sequence | Synthetic peptide located within the following region: APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD |
| Molecular Weight | 25kDa |
| Conjugation | FITC |
Storage & Handling
−| Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PIMT
−
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
PCMT1 Rabbit Polyclonal Antibody (FITC) (orb2114106)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review