PSCA recombinant protein

Référence NB-21-25560

Conditionnement : 100ug

Marque : Neo Biotech


PSCA recombinant protein

Product name PX-P5184-100
Uniprot ID O43653
Uniprot link https://www.uniprot.org/uniprot/O43653
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Molecular weight 10.13 kDa
Protein delivered with Tag? His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Leu12-Ser86
Protein Accession O43653
Aliases /Synonyms Prostate stem cell antigen
Reference PX-P5184
Note For research use only
Molecular Constructor
Leu12–Ser86 His