Images
QC Test

  • Specification

    Product Description

    Human QPCTL full-length ORF ( AAH11553.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

    Sequence

    MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    59.3

    Interspecies Antigen Sequence

    Mouse (91); Rat (91)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — QPCTL

    Entrez GeneID

    54814

    GeneBank Accession#

    BC011553.1

    Protein Accession#

    AAH11553.1

    Gene Name

    QPCTL

    Gene Alias

    FLJ20084

    Gene Description

    glutaminyl-peptide cyclotransferase-like

    Gene Ontology

    Hyperlink

    Other Designations

    glutaminyl cyclase-like

  • Interactome