Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Rbpj Peptide - middle region

Rbpj Peptide - middle region

Imprimer Imprimer
Identifiez-vous

Référence orb2006127-100ug

Conditionnement : 100ug

Marque : Biorbyt


Rbpj Peptide - middle region

SKU: orb2006127
This product can be custom made

Description

Rbpj Peptide - middle region, also known as AI843960, CBF1, Igkjrb, Igkrsbp, RBP-J, RBPjk, Rbpsuh, is a synthetic peptide designed for use in combination with Rbpj Rabbit Polyclonal Antibody (orb581277). It corresponds to the sequence MGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET and is supplied in a lyophilized powder. This peptide is for research use only.

Images & Validation

−
Rbpj Peptide - middle region
Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with Rbpj Rabbit Polyclonal Antibody (orb581277). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

−
Protein SequenceMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET

Storage & Handling

−
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
AI843960, CBF1, Igkjrb, Igkrsbp, RBP-J, RBPjk, Rbpsuh
−

Quick Database Links

UniProt
Q3UM17
RefSeq (Protein):NP_001074396

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001074396

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide
WB
Western Blot (IB, immunoblot)
View Protocol