Recombinant EGF (Epidermal growth factor), Human, AF
Référence orb1179132-5mg
Conditionnement : 5mg
Marque : Biorbyt
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Recombinant EGF (Epidermal growth factor), Human, AF
Catalog Number: orb1179132
| Catalog Number | orb1179132 |
|---|---|
| Category | Proteins |
| Description | Recombinant EGF (Epidermal growth factor), Human, AF |
| Tested applications | ELISA |
| Reactivity | Human |
| Tag | His-tag at the N-terminus |
| Form/Appearance | Lyophilized |
| Purity | > 95% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Entrez | 1950 |
| Protein Sequence | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRLE with polyhistidine tag at the C-terminus. |
| Source | Escherichia coli |
| Biological Activity | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 0.05-0.12 ng/mL. The specific activity of recombinant human EGF is approximately > 1.4 x 106 IU/mg. |
| Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Alternative names | Urogastrone, URG |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |