Recombinant EGF (Epidermal growth factor), Mouse, AF
Référence orb1178984-100ug
Conditionnement : 100ug
Marque : Biorbyt
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Recombinant EGF (Epidermal growth factor), Mouse, AF
Catalog Number: orb1178984
| Catalog Number | orb1178984 |
|---|---|
| Category | Proteins |
| Description | Recombinant EGF (Epidermal growth factor), Mouse, AF |
| Tested applications | ELISA |
| Reactivity | Mouse |
| Tag | His-tag at the N-terminus |
| Form/Appearance | Lyophilized |
| Purity | > 98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Entrez | 13645 |
| Protein Sequence | MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR with polyhistidine tag at the C-terminus. |
| Source | Escherichia coli |
| Biological Activity | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 80 pg/mL. The specific activity of recombinant mouse EGF is approximately > 1 x 107 IU/mg. |
| Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Alternative names | Urogastrone, URG |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |