Recombinant Mouse LEFTY1 Protein, N-His

Référence NB-21-33439

Conditionnement : 100µg

Marque : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q64280
Molecular weight:
34.74 kDa
Asn81–Pro368

Specifications Recombinant Mouse LEFTY1 Protein, N-His

Product name ARO-P10524-100
Uniprot ID Q64280
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP
Molecular weight 34.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn81-Pro368
Aliases /Synonyms Left-right determination factor B, Left-right determination factor 1, LEFTYB, LEFTY1, Protein lefty-1, LEFTB, Protein lefty-B
Reference ARO-P10524
Note For research use only.
Molecular Constructor
Asn81–Pro368
Product name ARO-P10524-1MG
Uniprot ID Q64280
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP
Molecular weight 34.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn81-Pro368
Aliases /Synonyms Left-right determination factor B, Left-right determination factor 1, LEFTYB, LEFTY1, Protein lefty-1, LEFTB, Protein lefty-B
Reference ARO-P10524
Note For research use only.
Molecular Constructor
Asn81–Pro368
Product name ARO-P10524-50
Uniprot ID Q64280
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP
Molecular weight 34.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn81-Pro368
Aliases /Synonyms Left-right determination factor B, Left-right determination factor 1, LEFTYB, LEFTY1, Protein lefty-1, LEFTB, Protein lefty-B
Reference ARO-P10524
Note For research use only.
Molecular Constructor
Asn81–Pro368

Documents

3D Representation

Recombinant Mouse LEFTY1 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Mouse LEFTY1 Protein, N-His” Cancel reply

Related products

  • ARO-A12836

    Anti-Mouse LEFTY1 Polyclonal Antibody