Recombinant Rat Calcium homeostasis modulator protein 2(Calhm2)

Référence orb2915457-20ug

Conditionnement : 20ug

Marque : Biorbyt


Recombinant Rat Calcium homeostasis modulator protein 2(Calhm2)

SKU: orb2915457

Description

This Recombinant Rat Calcium homeostasis modulator protein 2(Calhm2) spans the amino acid sequence from region 1-323.

Images & Validation

Key Properties

Biological OriginRattus norvegicus (Rat)
Expression Region1-323
Protein Lengthfull length protein
Protein SequenceMAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLTA IGVPALALFLIGVILNNHTWNLVAECQYRRAKNCSAAPTFLLLSSILGRAAVAPVTWSVI SLLRGEAYVCALSEFVDPSSLTAGDEGFPPDHATEILARFPCGEGPANLSGFREEVSRRL KYESQLFGWLLIGVVAILVFLTKCFKHYCSPLSYRQEAYWAQYRTNEDQLFQRTAEVHSR VLAANNVRRFFGFVALNKDDEELVTKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH KWAQGLTGNGTAPDNVEMALLTV

Storage & Handling

StorageStorage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Form/AppearanceLyophilized powder
Buffer/PreservativesTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Calcium homeostasis modulator protein 2, Protein FAM26B

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide