SCDGFB (PDGFD) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommended Dilution	WB
Reactivities	Human
Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Predicted Protein Size	40 kDa
Gene Name	platelet derived growth factor D
Database Link	NP_079484 Entrez Gene 80310 Human UniProt ID Q9GZP0
Background	The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f
Synonyms	IEGF; MSTP036; SCDGF-B; SCDGFB
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rabbit: 93%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Focal adhesion, Gap junction, Melanoma, Prostate cancer, Regulation of actin cytoskeleton