SLC25A46 (Solute Carrier Family 25 Member 46, TB1) (AP)
Référence MBS6402583-5x0,1mL
Conditionnement : 5x0.1mL
Marque : MyBiosource
SLC25A46 (Solute Carrier Family 25 Member 46, TB1) (AP)
SLC25A46 Antibody – Rabbit Polyclonal
For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6402583MBS6402583 is an antibody targeting SLC25A46. Also known as SLC25A46 (Solute Carrier Family 25 Member 46, TB1) (AP). Reactive in Human, Mouse, Rat, Zebrafish. Host: Rabbit. More details
Product Overview
Online Datasheet in PDFProduct Name
SLC25A46, Polyclonal Antibody
Full Product Name
SLC25A46 (Solute Carrier Family 25 Member 46, TB1) (AP)
Product Gene Name
anti-SLC25A46 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat, Zebrafish
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes SLC25A46. Species Crossreactivity: Human, mouse, rat and zebrafish.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Reconstituted product is stable for 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
N-terminus of SLC25A46 corresponding to RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP
Conjugate
AP
Note
Preservative Free
Product Categories/Family for anti-SLC25A46 antibody
Antibodies; Ion Channel
Applications Tested/Suitable for anti-SLC25A46 antibody
Western Blot (WB)
Application Notes for anti-SLC25A46 antibody
WB: 5ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Other Notes
Small volumes of anti-SLC25A46 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Additional Details
NCBI/Uniprot data below describe general gene information for SLC25A46. It may not necessarily be applicable to this product.
Protein Family
Solute carrier family
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Product Note
Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.